Abstract
Acute myeloid leukemia (AML), the most frequent leukemia in adults, is driven by recurrent somatically acquired genetic lesions in a restricted number of genes. Treatment with tyrosine kinase inhibitors has demonstrated that targeting of prevalent FMS-related receptor tyrosine kinase 3 (FLT3) gain-of-function mutations can provide significant survival benefits for patients, although the efficacy of FLT3 inhibitors in eliminating FLT3-mutated clones is variable. We identified a T cell receptor (TCR) reactive to the recurrent D835Y driver mutation in the FLT3 tyrosine kinase domain (TCRFLT3D/Y). TCRFLT3D/Y-redirected T cells selectively eliminated primary human AML cells harboring the FLT3D835Y mutation in vitro and in vivo. TCRFLT3D/Y cells rejected both CD34+ and CD34− AML in mice engrafted with primary leukemia from patients, reaching minimal residual disease-negative levels, and eliminated primary CD34+ AML leukemia-propagating cells in vivo. Thus, T cells targeting a single shared mutation can provide efficient immunotherapy toward selective elimination of clonally involved primary AML cells in vivo.
Similar content being viewed by others
Main
Neoantigens represent an attractive group of targets in cancer immunotherapy, as they are tumor specific and can be recognized by T cells as foreign in the context of major histocompatibility complex (MHC)1,2,3,4. Neoantigenic burden is an important determinant of clinical success upon checkpoint inhibition5,6,7, and case reports have demonstrated that neoantigen-reactive T cells can mediate clinical responses8,9,10. This has brought hope that T cells genetically modified to express TCRs derived from neoantigen-reactive T cells could provide efficient adoptive cell therapy. Patient T cells do, however, spontaneously recognize only 1–2% of candidate neoantigens predicted to be expressed and presented on human leukocyte antigen (HLA) in solid cancer11. As the large majority is unique to the individual patient, therapeutic targeting of neoantigens generally becomes a highly personalized effort12. In addition to being resource demanding, such a strategy might not benefit patients in time. By contrast, public neoantigens derived from recurrent oncogenic mutations have the advantage that a single TCR with off-the-shelf availability could target larger patient groups. Although shared mutations resulting in neoantigens presented on frequently expressed HLA alleles are rare in solid cancer, promising results were recently shown with T cells engineered to express a TCR targeting mutant KRAS in a patient with pancreatic adenocarcinoma13 and mutant p53 in a patient with breast cancer14.
AML is, in contrast to solid tumors, characterized by recurrent driver mutations in a restricted number of genes15, many of which are screened for in routine diagnostics. The only curative therapeutic option for many patients with AML today is allogeneic hematopoietic stem cell transplantation (allo-HSCT). Allo-HSCT remains, however, associated with high relapse rates as well as transplant-related morbidity and mortality resulting from donor T cells attacking healthy recipient cells, causing severe graft-versus-host disease16, and often a suitable donor cannot be identified. This has prompted development of alternative cellular therapies17,18. Successful targeting of the lymphoid-specific molecule CD19 in chimeric antigen receptor (CAR) T cell therapy of acute lymphocytic leukemia, has led to attempts at also directing CARs to myeloid cell surface antigens, including CD33 (ref. 19), CD123 (ref. 20) and FLT3 (ref. 21), overexpressed on AML cells. However, these molecules are also highly expressed on normal myeloid progenitor cells and even on hematopoietic stem cells, representing a major challenge22,23,24. Thus, CAR T cell therapies targeting these molecules are associated with toxicities and a need for transplantation to rescue normal hematopoiesis after a short period of treatment (for example, NCT03126864) (ref. 25). It is also unclear whether all AML-propagating cells express these antigens and therefore whether targeting has curative potential26.
Cytotoxic cells modified to express TCRs provide an opportunity to also target intracellular antigens with restricted expression in normal tissues, such as the specialized DNA polymerase terminal deoxynucleotidyl transferase (TdT)27, dramatically broadening the repertoire of potential targets. To this end, TCRs recognizing Wilms tumor 1 (WT1) were recently shown to reduce relapses in patients with AML after transplantation28. A TCR recognizing the recurrent neoantigen nucleophosmine 1 (NPM1) presented on HLA-A*02:01 (ref. 29,32. While recurrent FLT3 mutations are frequently known to represent secondary and accelerating AML mutations15,33,66, our reanalysis of 58 published FLT3D835Y-mutated AML patient samples15,45 demonstrated that this FLT3 mutation frequently is clonal and, in some cases, also might be the initiating mutation or secondary only to a CH mutation. These data are in agreement with the high VAF for FLT3D835Y in all included patients with AML harboring this mutation, where the only selection criterion upfront was the presence of the mutation. In sum, this highlights the therapeutic and potentially curative potential of eradicating FLT3D835Y-mutated AML clones. Furthermore, in cases in which TKIs effectively target FLT3 ITD but select for AML subclones with FLT3 point mutations, including FLT3D835Y, resistant to first-generation as well as second-generation TKIs35,36,37, FLT3D835Y-mutation-specific TCR treatment could be combined with TKIs. As part of a paradigm in which combination regimens are tailored based on tumor molecular profiles, TCR therapies targeting specific recurrent point mutations provide a potential means for highly efficacious eradication of specific tumor clones.
TCRs can access recurrent mutations currently inaccessible to CARs. Moreover, TCRs might have inherent advantages relative to CARs that improve T cell persistence and antigen sensitivity67. Today, TCR-based therapies are mostly applied in the form of genetically modified T cells, although soluble bispecific TCR engagers have emerged as new opportunities for off-the-shelf therapies at lower cost68. The results presented here show that a TCR targeting a single shared neoantigen generated from a healthy donor can provide highly efficacious and specific cancer treatment in vivo in multiple disease-relevant models, paving the way for future off-the-shelf, tumor-specific immunotherapies.
Methods
This study was approved by the Regional Committee for Medical and Health Research Ethics South-East Norway (2018/879, 2018/1246 and 2015/2357), the Institutional Review Board and the Data Protection Officer, Oslo University Hospital, the Swedish Ethical Review Authority, Stockholm (EPN 2017/2085-31/2) and the Ethical Committee in Central Denmark Region (1-45-70-88-21) and was performed in accordance with the Declaration of Helsinki. The Norwegian Food Safety Authority (application ID 17500) and Stockholms Djurförsöksetiska nämnd (17978-2018) approved all animal experiments.
Primary patient cells, healthy blood donor cells and cell lines
Buffy coats (PBMCs) from healthy donors were provided by the blood bank of Oslo University Hospital, and PB or BM MNCs from patients with leukemia were isolated from cryopreserved, biobanked material (ethical approvals 2018/879 and 2018/1246). MNCs derived by density-gradient centrifugation (Axis-Shield) were stained to determine HLA-A2 expression by flow cytometry. To confirm the presence of FLT3D835Y, genomic DNA was extracted (QIAGEN DNeasy purification kit) from patient primary cells, and samples were sequenced using the TruSight Myeloid panel (Illumina). Information regarding the patients’ sex (reported in Supplementary Table 2) was not considered during the design of the study but was part of the overall clinical information obtained at the hospital. No sex- or gender-based analysis was performed because each patient is shown individually in the study.
Epstein–Barr virus-transformed lymphoblastoid cell lines (EBV-LCL) were generated from HLA-A2+ and HLA-A2− PBMCs as described previously27. All other cell lines were gifted or obtained from the American Type Culture Collection (ATCC) or the German Collection of Microorganisms and Cell Cultures (DSMZ) as indicated in the Nature Portfolio Reporting Summary. Authentication was performed by short tandem repeat DNA profiling by Labcorp DNA Identification Lab (formerly Genetica, https://celllineauthentication.com/). Cell line cultures were grown in humidified cell incubators containing 5% CO2 at 37 °C using media according to provider guidelines and were tested frequently for potential mycoplasma contamination.
Minigene design
For generation of T cell responses, a minigene was designed to encode predicted epitopes (https://services.healthtech.dtu.dk/service.php?NetMHC-4.0) containing the FLT3D835Y mutation, codon optimized and synthesized by GenScript. Subsequently, it was cloned into the pCIpA102 vector for in vitro mRNA transcription using the RiboMAX Large Scale RNA production system (Promega), as previously described69,70. The minigene encoded the FLT3 amino acid sequence KICDFGLARYIMSDSNYVVRGNVRLARLP (FLT3D835Y 9-mer and 10-mer are underlined and the mutation in position 1 is shown in bold).
Induction of antigen-specific T cells
Monocytes from HLA-A2+ healthy donors were isolated on day −4 using CD14-reactive microbeads and the autoMACS Pro Separator (Miltenyi Biotec). The CD14− PBMC fraction was cryopreserved for later use. The monocytes were then cultured for 3 d in CellGro GMP DC medium (CellGenix) with 1% (vol/vol) human serum (HS; Trina biotech), 1% (vol/vol) penicillin–streptomycin (P/S; Sigma-Aldrich), 50 IU ml−1 IL-4 (PeproTech) and 800 IU ml−1 GM-CSF (Genzyme). Subsequently, moDCs were matured for 14–16 h by adding lipopolysaccharide (Sigma-Aldrich) and IFN-γ (PeproTech) to final concentrations of 10 ng ml−1 and 100 IU ml−1, respectively. On day −1, naive CD8+ T cells were isolated from the autologous CD14− cryopreserved PBMCs by use of the autoMACS Pro Separator and a CD8+ T cell-isolation kit, into which CD45RO- and CD57-reactive beads (Miltenyi Biotec) were added. On day 0, moDCs were collected, electroporated with mRNA and co-cultured with naive T cells in DC–T cell medium with 30 ng ml−1 IL-21 (PeproTech) at a DC:T cell ratio of 1:4. After 10 d, co-cultures were screened for the presence of FLT3D/Y pMHC multimer-reactive CD8+ T cells. pMHC multimers labeled with PE and APC were prepared in house as described previously71,72. Viable CD8+pMHC+ T cells (double positive for PE- and APC-conjugated pMHC multimers) were sorted by flow cytometry.
Expansion of memory T cells reactive to FLT3D/Y in samples from patients with AML following HSCT
For in vitro expansion of potential memory T cells reactive to the FLT3D/Y-mutant peptide in patients with AML that had undergone HSCT, cryopreserved PB samples were thawed and resuspended in Iscove’s Modified Dulbecco’s Medium (IMDM) with 20% (vol/vol) FCS (Trina biotech) and 0.1 mg ml−1 DNase. Viable cells were resuspended at a concentration of 1 M ml−1 and pulsed with the FLT3D/Y peptide at 100 ng ml−1 for 2 h at 37 °C. Cells were washed and resuspended at 3.75 million cells per ml in IMDM with 5% HS, 1× P/S and 20 U ml−1 IL-2 before culturing for 5 d. Identification of T cells reactive to the peptide was performed by staining with pMHC multimers as described above.
Sorting and cloning of pMHC multimer+CD8+ T cells
PBMCs from three healthy donors were mixed at an equal ratio (1:1:1) and irradiated with 35 Gy, washed and resuspended in X-VIVO 20 medium (Lonza, BioNordika) with 5% HS and 1% P/S (T cell medium). A total of 0.2 × 106 irradiated cells (feeders) were placed into tissue culture-treated 96-well plates and were supplemented with 100 μl T cell medium containing 2 μg ml−1 phytohemagglutinin (Remel Thermo Scientific), 80 ng ml−1 IL-2 (R&D Systems) and 4 ng ml−1 IL-15 (PeproTech). FLT3D/Y co-cultures were then collected and stained with LIVE/DEAD Fixable Near-IR, anti-CD3 antibody, anti-CD8a antibody and PE- and APC-conjugated pMHC multimers, and, using the FACSAria II (BD Biosciences) cell sorter, CD8+, pMHC-double-positive multimer populations were sorted as single cells into 96-well plates containing feeders. After 7 d, cultures were supplied with fresh T cell medium containing 1,750 U ml−1 IL-2 and 4 ng ml−1 IL-15, and expanding clones were identified by microscopy. On day 14, growing clones were restimulated with feeder cells prepared as described above and stained with FLT3D/Y pMHC multimers. To assess functionality after expansion, clones were stimulated with K562 cells pulsed with FLT3D/Y or FLT3WT peptides and assessed for CD137 upregulation.
TCR sequencing
The sequences for paired TCR-α and TCR-β chains from two clones and 55 single cells reactive to FLT3D/Y pMHC multimers were amplified as previously described but modified and adapted for the targeted amplification of transcripts encoding TCR-α and TCR-β (refs. 27,38,55). The MiXCR script was used to analyze sequencing data, and an in-house Python script TCR primer was used to reconstruct full-length TCR chains as described previously55,73. The output was manually verified using IMGT/V-QUEST74. For identified TCRs, codon-optimized sequences for TCR-α and TCR-β variable fragments were synthesized and cloned by GenScript.
Gene transfer to human PBMCs and cell lines
HLA-A2+ healthy donor-derived and patient-derived PBMCs were transduced to express FLT3D/Y- and NY-ESO-1 (1G4)-specific TCRs, as detailed in ref. 27. Briefly, 2 × 106 PBMCs per ml in CellGro GMP DC medium with 5% (vol/vol) HS, IL-7 and IL-15 (5 ng ml−1 each, PeproTech) were added to antibody-coated plates (anti-CD3 clone OKT3, eBioscience and anti-CD28 clone CD28.6, eBioscience) and incubated at 37 °C with 5% CO2 for 72 h. Retroviral supernatants were generated as described previously27. PBMCs were collected, resuspended in CellGro GMP DC medium with 5% HS, IL-7 and IL-15, mixed with retroviral supernatant, placed in non-tissue culture-treated six-well plates precoated with RetroNectin (20 μg ml−1, Takara) and spinoculated at 900g for 60 min twice on consecutive days. Transduction efficiency was determined after 3 d by staining with anti-mouse TCR-β chain antibody and/or the pMHC multimer followed by flow cytometry. Before functional experiments, cells were cultured for 48–72 h in CellGro GMP DC medium containing low concentrations of cytokines (0.5 ng ml−1 IL-7 and IL-15). Alternatively, cells were frozen for later experiments.
BV173, ML-2, RS4;11 and NALM-6 cell lines were transduced as described above using retroviral supernatant containing the FLT3D/Y minigene. For in vivo experiments, the BV173 cell line was stably transduced to express the FLT3D/Y minigene, firefly luciferase and GFP (hereafter, BV173D835Y). Complementary DNA encoding FLT3D/Y and HLA-A2 was cloned into the pCIpA102 vector for production of mRNA, as previously described70,71
Immunoprecipitation-targeted mass spectrometry analysis of FLT3 peptides presented on HLA
Monoallelic B721.221 cells expressing HLA-A2 were transduced to express the mutant FLT3 amino acid sequence VLVTHGKVVKICDFGLARYIMSDSNYVVRGNARLPVK. One hundred million cells from the B721.221 line and 400 million cells from patient samples (patients 1 and 3) were lysed in PBS containing 1% lauryl maltoside, 0.5 mM EDTA, 1 mM PMSF and Sigma protease inhibitors (1:200) for 1 h at 4 °C (1 ml lysis buffer per 100 million cells). The clarified cell lysates were then added to 200 µl of AminoLink Plus bead slurry (Thermo Fisher Scientific) coated with pan-HLA class I-specific antibody (W6/32, BioXCell) to enrich for HLA peptides27. The HLA-bound peptides were then sequentially eluted three times, each with 1 ml of 1% TFA. Peptide elutions were pooled and desalted using the Discovery DSC-C18 SPE column. The peptides were vacuum concentrated and dissolved in 25 μl of 3% acetonitrile containing 0.1% TFA, following spike-in with 200 pg of heavy isotope-labeled peptide (YI(13C6,15N)MSDSNYV). The peptide solution (5 μl) was analyzed using an EASY-nLC 1000 system (Thermo Fisher Scientific) connected to a Q Exactive HF mass spectrometer (Thermo Electron) equipped with a nano-electrospray ion source. For liquid chromatography separation, an EASY-Spray ES902 column (C18, 2-µm beads, 100 Å, 75-μm inner diameter) capillary with a bed length of 25 cm was used. A flow rate of 300 nl min−1 was employed with a solvent gradient of 7–35% B in 55 min to 90% B in 3 min. Solvent A was 0.1% formic acid, and solvent B was 0.1% formic acid–90% acetonitrile. The mass spectrometer was operated in parallel reaction-monitoring mode to specifically target the presence of endogenous FLT3 mutant (m/z = 1,091.47381+) and spiked-in isotope-labeled peptide (m/z = 1,098.49281+), eluting within a retention time window of 27–31 min, as determined using a synthetic analog. The MS/MS spectra using higher-energy collision-induced dissociation were acquired with a resolution of R = 15,000 after accumulation to a target of 1 × 105. The normalized collision energy was set to NCE 27, and the isolation window was m/z = 2.0. The maximum allowed ion accumulation for the MS/MS spectrum was 120 ms. Raw data were analyzed using Xcalibur software and Skyline (MacCoss Lab Software).
pMHC-stability assay
HLA-A2 molecules were prepared in house, as previously described71,75,76. The pMHC-stability assay was performed as previously described38 with minor modifications. UV-mediated peptide-exchange reactions were performed for 1 h, followed by incubation of the resulting product at 4 °C. The next day, streptavidin-coated beads were washed twice with PBS–1% Tween. The peptide–HLA monomers were coupled with the washed beads for 10 min at room temperature. After coupling, the beads were washed twice with PBS–1% Tween and resuspended in 200 μl. An aliquot of 20 μl beads was set aside for the 0-h time point, while the remaining beads were incubated at 37 °C. Twenty microliters of beads were collected at 3, 6, 12 and 24 h of incubation. After collecting at each time point, the beads were stained with 30 μl of anti-HLA-A2–PE antibody (343305, BioLegend, 1:100 dilution) for 10 min at room temperature. Samples from all time points were analyzed immediately after staining on a BD LSR II Flow Cytometer.
Antibodies, dyes and flow cytometry
For surface antibody staining of human PB and BM cells, antibodies were added to cells for 15–20 min at 4 °C, followed by washing steps. For intracellular staining, cells were suspended in Cytofix/Cytoperm (BD Biosciences) solution for 20 min, washed with Perm/Wash buffer (BD Biosciences) and then stained with antibodies. For mouse PB, BM and spleen, cells were processed into a single-cell suspension as previously described77 and Fc receptor blocked (human, Miltenyi Biotec; mouse, produced by mouse hybridoma cell line clone 2.4 G2, ATCC, HB-197) for 10 min at 4 °C before staining with antibodies for 15–20 min at 4 °C. All fluorescently conjugated antibodies are described in Supplementary Table 10 and the Nature Portfolio Reporting Summary. In PDX mice, the percentage of myeloid cells was determined as a fraction of combined mouse and human leukocytes (mCD45+hCD45+), subtracting hCD3+ events accounting for infused T cells. Flow cytometry analysis was performed on the BD LSR II flow cytometer or the BD LSRFortessa machine (both BD Biosciences), while cell sorting was performed on the FACSAria Fusion cell sorter (BD Biosciences). Data were analyzed using FlowJo (TreeStar) or FACSDiva (BD Biosciences) software. To visually display flow cytometry data, we used an unsupervised nonlinear dimensionality-reduction algorithm such as t-SNE by using FlowJo (TreeStar) software.
T cell-activation assays
T cells transduced to express TCR were co-cultured with cell lines or primary patient tumor cells at an E:T cell ratio of 1:2 (100,000:200,000 cells per well), and reactivity was investigated by measuring CD137 upregulation or IFN-γ release. When indicated, target cells were pulsed with FLT3D/Y or FLT3WT peptide (purities >90%) or 161 single-amino acid-substituted variants of the FLT3D/Y peptide (purity >70%) (GenScript Biotech) for 1–2 h or electroporated with mRNA encoding either FLT3WT or the FLT3D/Y minigene. Cells were placed in round- or flat-bottom 96-well plates and, after 18–20 h of co-incubation, were centrifuged at 700g for 2 min. Supernatants were collected for measurement of IFN-γ levels by ELISA, while cells were washed and stained with anti-CD137 antibody. In some experiments, transduced T cells were labeled with 0.75 μM CTV to distinguish them from target cells. Reagents for the IFN-γ ELISA were acquired from BD Pharmingen or R&D Systems: mouse anti-human IFN-γ capture antibody (NIB42), Biotin Mouse Anti-Human IFN-γ-detection antibody (4S.B3), streptavidin–HRP, stabilized tetramethylbenzidine and hydrogen peroxide as substrate solutions, sulfuric acid as the stop solution and recombinant human IFN-γ protein as the standard. The assay was performed according to the manufacturer’s instructions.
Flow cytometry-based cytotoxicity assay using cell lines as targets
Transduced cell lines stably expressing the FLT3D/Y minigene were co-cultured with CTV-labeled T cells transduced to express TCR at an E:T cell ratio of 1:2 (75,000:150,000 cells per well) for 48 h in round-bottom 96-well plates in triplicates. Following co-culture, cells were collected, washed and stained with human anti-CD3, anti-CD8 and anti-CD4 antibodies and LIVE/DEAD NIR for 15–20 min. Cells were then washed and resuspended in FACS buffer containing 10,000 CountBright Absolute Counting Beads (Thermo Fisher). An equal number of bead events (3,500) were recorded from every well. Normalized data were reported as percentage of the mean of the number of viable tumor cells acquired from three parallel wells co-cultured with TCR1G4 or TCRFLT3D/Y cells from each donor.
Flow cytometry-based assays for T cell activation and cytotoxicity using primary human samples
PB or BM samples from patients were thawed and resuspended in IMDM with 20% (vol/vol) FCS (Trina biotech) and 0.1 mg ml−1 DNase. Cells were centrifuged at 200g for 15 min at room temperature and transferred to round-bottom 96-well plates for assays measuring CD137 upregulation on T cells transduced to express TCR or cytotoxicity on target cells. Normal CD19+ B cells were isolated from healthy donor buffy coat MNCs using CD19-reactive microbeads and the autoMACS Pro Separator (Miltenyi Biotec) and transferred to round-bottom 96-well plates for assays measuring cytotoxicity on target cells. Individualized antibody panels and gating strategies to identify malignant blasts and normal leukocyte populations were designed after reviewing diagnostic phenoty** available in the hospital records. Allogeneic or, for patients 1–3, also autologous patient-derived T cells transduced to express TCRs, were used in the experiments. Cells transduced to express TCR were prelabeled with CTV dye to distinguish them from target cells. For cytotoxicity assays, 75,000 T cells per well were co-incubated with 150,000 target cells in three parallel wells per condition for 72 h and then stained with individualized antibody panels for flow cytometry. CountBright Absolute Counting Beads were used as described above. Examples of the gating strategy used to identify live tumor cells in patients are shown in Extended Data Fig. 6a. For patients 1–6 and 8, myeloid cells were identified as CD3−CD19−CD20−, normal T cells as CD3+ and normal B cells as CD19+CD20+. Cells from patient 7 were obtained from Jackson Laboratory (stock ID J000106565), and the patient-specific phenotypic markers CD33 and CD19 were used to identify leukemia cells based on the characterization profile from the provider.
TCRFLT3D/Y cell activity in the xenograft leukemia cell line model
This study was approved by the Norwegian Food Safety Authority (application ID 17500) and performed in compliance with institutional guidelines and the 2010/63/EU directive. Mice were observed for clinical signs of tumor spreading and were killed if they developed >20% weight loss, hunched posture, ruffled fur, limb paralysis or enlarged spleens. Maximum tumor burden was not exceeded. Experiments were terminated 2 months after T cell injection to avoid graft-versus-host disease, and surviving mice were killed humanely by cervical dislocation. Six mice were housed per cage in Eurostandard Type III cages (macrolone) with a light cycle from 7 a.m. to 7 p.m. at 22 ± 1 °C with 62 ± 5% humidity. Female (8–10-week-old) NSG (Jackson Laboratory) mice, bred in house, were sublethally irradiated (2.5 Gy, MultiRad225 X-ray, RPS Services) on day −15, and 4 × 106 cells of the human B-ALL cell line BV173D835Y were injected on day −14 through the tail vein. After leukemia was confirmed by BLI on day −1, mice were treated with 107 T cells transduced to express TCR1G4 or TCRFLT3D/Y. A group of control mice did not receive T cell injections. All mice were injected intraperitoneally (i.p.) daily with 2,500 IU IL-2 (R&D Systems). BLI imaging (by the IVIS Spectrum in vivo imaging system; analysis with Living Image software version 4.5.2, PerkinElmer) and blood analysis by flow cytometry were performed continuously. BM was collected at the endpoint and processed for flow cytometry to analyze the presence of T cells and tumor cells.
Activity of TCRFLT3D/Y cells in four primary AML PDX models
Experiments were approved by Stockholms Djurförsöksetiska nämnd (17978-2018). The maximal tumor burden permitted was defined by the impact on the animal’s health. Mice engrafted with leukemic cells were continuously monitored according to Karolinska Institutet’s health assessment, and no animal exceeded the humane endpoint. The housing conditions were 21 °C and 45–50% humidity. Two to five mice were housed per cage in IVC-Mouse GM500 cages with a light cycle from 4 a.m. to 4 p.m. (patient 7) or from 6 a.m. to 6 p.m. (patient 1). BM was collected from femur, tibia and crista from both hind legs at terminal analysis. Mainly female mice were used in this study, but, when both sexes were used, they were equally distributed within the treatment groups. No sex-based analysis was thus performed.
Model 1
Female NOD.Cg-Prkdcscid Il2rgtm1Wjl Tg(CMV IL3,CSF2,KITLG)1Eav/MloySzJ (NSG-SGM3) mice stably engrafted with FLT3D835Y-expressing HLA-A2+ AML cells from patient 7 (Supplementary Table 2 and 3) at 5 weeks of age were obtained from Jackson Laboratory (stock ID J000106565). Upon arrival (5.5 weeks after transplantation), PB myeloid engraftment was confirmed by flow cytometry, and mice were allocated to treatment groups (TCRFLT3D/Y or TCR1G4 cells), resulting in a similar mean human myeloid engraftment between the groups before infusion with T cells. Cryopreserved T cells transduced to express TCR were thawed and cultured in X-VIVO 20 medium (Lonza) with 5% HS, 1% penicillin–streptavidin and 5 ng ml−1 IL-7 and IL-15 for 3–4 d before treatment. T cells containing 5 × 106 CD8+mTCR-β+ T cells were injected through the lateral tail vein, and all mice received daily i.p. injections of 2,500 IU human IL-2 (R&D Systems). At day 8 after T cell infusion, half of the mice received a second dose of 5 × 106 CD4-depleted (Miltenyi Biotec) TCRFLT3D/Y or TCR1G4 T cells. As no differences were observed between the mice receiving one or two doses of T cells, the data from these mice were pooled. The effect of the T cells was monitored in serially collected PB and at termination 15 d after T cell treatment in the BM and spleen through detailed flow cytometry analysis.
Model 2
BM CD34+ cells from patient 1 (FLT3D/Y and HLA-A2+; Supplementary Tables 2 and 3) were obtained by CD34 magnetic bead enrichment (Miltenyi Biotec) according to the manufacturer’s instructions and as previously described78. A total of 3 × 105 CD34+ cells per mouse were intrafemorally injected into sublethally irradiated (3.3 Gy, X-ray source) female and male NSG-SGM3 mice (Jackson Laboratory, stock 013062) 9 weeks of age. Upon confirmation of stable PB myeloid engraftment 7 weeks after transplantation, mice were allocated to treatment groups (TCRFLT3D/Y or TCR1G4 cells) based on their engraftment levels as described for patient 7. T cells containing 5 × 106 CD8+mTCR-β+ T cells were infused into each mouse by lateral tail vain injections, and all mice received daily i.p. injections of 2,500 IU human IL-2 for 2 weeks, followed by less frequent injections. Mice were monitored using serially collected PB and at termination 34 d after T cell treatment with the BM and spleen.
Model 3
To mimic an MRD setting, secondary intrafemoral transplantation of BM cells from NSG mice (Jackson Laboratory, stock 005557) engrafted with material from patient 1 was performed into sublethally irradiated (2.5 Gy, X-ray source) female NSG mice 12–13 weeks of age. Following confirmation of low but stable leukemic engraftment 20 weeks after transplantation, mice were treated with TCRFLT3D/Y or TCR1G4 CD4-depleted (Miltenyi Biotec) T cells (10 × 106 T cells, containing 90% CD8+ and 10% CD4+ T cells). All mice were injected i.p. daily with 2,500 IU human IL-2. The effect of the T cells was evaluated in the BM 11 d after T cell treatment.
Model 4
Following secondary transplantation of BM from mice engrafted with patient 1 cells, BM from three NOD.Cg-Prkdcscid Il2rgtm1Sug Tg(CMV-IL2)4-2Jic/JicTac (NOG-hIL2, Taconic) mice was isolated and cultured for 48 h in CellGro GMP DC medium with 5% HS, IL-7 and IL-15 either with no T cells or with TCR1G4 or TCRFLT3D/Y cells (E:T cell ratio, 1:2). After 48 h, the contents of each well were collected and intrafemorally injected into sublethally irradiated (2.25–2.5 Gy) female NSG mice 8–13 weeks of age. Engraftment levels were monitored in serially collected PB samples by flow cytometry. Data were pooled from two individual experiments. Differences in engraftment dynamics between mice engrafted with AML cells precultured with TCRFLT3D/Y or TCR1G4 cells or without T cells was assessed by multilevel linear regression using the R package ‘lmerTest’. Sampling time points and groups are treated as an interaction term with random effects for individual mice. Because the engraftment at the first time point was 0 for all mice except one, we fixed the intercept as 0. Estimated marginal means of models were obtained and compared between three groups using the R package ‘emmeans’. Multiple tests were corrected using the Benjamini–Hochberg method. Only mice that could be followed until the end of the experiment were included in the analysis.
Whole-exome sequencing of cells from patient 1 and PDX mice
DNA was isolated from AML cells purified with the FACSAria Fusion cell sorter (BD Biosciences) from patient 1 using the Maxwell RSC Cultured Cells DNA Kit (Promega), including primary BM AML blasts (CD3−CD19−) and T cells (CD3+CD8+CD19−CD33− and CD3+CD4+CD19-CD33-) and BM mCD45−hCD45+CD3−CD19− cells from one untreated and one TCR1G4-treated PDX mouse from model 2. Whole-exome sequencing libraries were prepared with the Lotus DNA Library Prep Kit (IDT). Exon regions were captured using xGen Exome Hyb Panel v2 and the xGen Hybridization and Wash Kit (IDT) on 4 July 2022 and 5 July 2022. After mixing with 1% PhiX, prepared libraries were sequenced using the NextSeq high-output kit (300 cycles) with settings ‘Read1, 151; Index1, 8; Index2, 8; Read2, 151’. Reads were aligned to the human (GRCh37) genome reference using Burrows–Wheeler Aligner version 0.7.17 with default parameter settings. PCR duplicates were marked with biobambam version 2.0.87. Reads were subjected to indel realignment and base quality score recalibration using GATK3 (version 3.8) and recalculation of MD/NM tags using SAMtools version 1.9. Errors associated with enzymatic fragmentation during library preparation were removed using FADE version 0.5.5, resulting in an average depth of 364 (331–439) in the final bam files79.
Mutations calling was performed using GenomonFisher (https://github.com/Genomon-Project/GenomonFisher) with the following parameters: (1) map** quality score ≥20, (2) base quality score ≥15, (3) number of total reads ≥8, (4) number of variant reads ≥5, (5) VAF ≥ 0.05, (6) VAF in paired T cells <0.1, (7) VAF in other non-paired normal controls <0.05 in all and average <0.01, (8) strand ratio in tumor ≠0 or 1, (9) VAF by base counts divided by VAF by read count ≥0.5 and ≤2, (10) P value by Fisher <0.1, (11) P value by EBFilter80 <0.001, (12) mutation on exons, (13) not on the repeat regions.
Mutations were annotated by ANNOVAR81. Copy number analysis was performed using CNACS82. The WT1H507P mutation was, together with the FLT3D835Y mutation, the only identified potential driver mutation in AML15,83.
Droplet digital PCR
ddPCR was performed to quantify clonal involvement. DNA from patient 1 with AML was isolated as explained above, and DNA from AML PDX mice was isolated through flow cytometry sorting of mCD45−mTer119−hCD45+CD3− cells (PDX patient 7) or hCD45+CD33+CD34−, hCD45+CD33+CD34+ and hCD45+CD19+ cells (PDX patient 1) and subjected to whole-genome DNA amplification using the REPLI-g Single Cell Kit (QIAGEN) according to the manufacturer’s instructions. Samples with <90 cells were excluded. Briefly, a 20-µl PCR reaction mixture containing 1× ddPCR supermix for probes (no dUTP) (Bio-Rad), 1× primer-probe assay (FLT3D835Y, dHsaMDV2010047; WT1H507P, dHsaMDS871718945; Bio-Rad) and 60 ng DNA was mixed with Droplet Generation Oil for Probes (Bio-Rad). Droplets were prepared according to the manufacturer’s instructions on a QX200 droplet generator (Bio-Rad) and subjected to PCR (Bio-Rad): 95 °C for 10 min, 40 cycles of 94 °C for 30 s and 55 °C for 60 s and a 10-min incubation at 98 °C. Plates were read on a QX200 droplet reader (Bio-Rad) and analyzed using QuantaSoft version 1.5.38.1118 software (Bio-Rad) to calculate VAFs and 95% confidential intervals. The numbers of FLT3D835Y cells in the AML PDX mice were determined by combining the information from the fraction of mutated cells identified by ddPCR, and the frequency of phenotypically defined subsets (hCD45+CD3− or hCD45+CD33+CD34− and hCD45+CD33+CD34+, respectively, for patients 7 and 1) in the BM as determined by flow cytometry, and the total number of MNCs in the BM was counted with Sysmex.
External AML-targeted sequencing data analysis
Mutation data (SNVs and indels) from AML patients reported by Papaemmanuil et al.15 were downloaded from https://www.cbioportal.org. VAF was estimated from reported alternative allele reads divided by sequencing depth for the position. Patients harboring a FLT3D835Y mutation were selected for in-depth analysis.
The order of FLT3 mutations in AML using VAF and the mutated cell fraction was determined from the publicly available mutation list identified by targeted DNA sequencing by Morita et al.45.
Statistical analysis and reproducibility
Statistical analysis was performed in GraphPad Prism versions 6–8 (GraphPad Software). Comparison of mean values between two experimental groups was conducted with unpaired, two-tailed Student’s test. The ordinary ANOVA test with adjustment for multiple comparisons with Tukey’s post hoc test was employed for comparisons of more than two experimental groups. To determine differences between in vivo treatment groups in the PDX mouse models, Kruskal–Wallis ANOVA with Dunn’s multiple-comparison test and two-tailed Mann–Whitney test were performed. P values < 0.05 were considered statistically significant. The investigators were not blinded to allocation during experiments or to outcome assessment. PDX models 1–3 were performed once each, and data for PDX model 4 were generated from two independent experiments with mice from all treatment groups represented in both experiments. No statistical method was used to predetermine sample size, and experiments were not randomized. Sample sizes were estimated based on preliminary experiments and are similar to those previously reported27,84. Due to the nature of the other in vitro experiments, blinding was not possible and is not generally performed in the field as the data acquisition is quantitative (flow cytometry or MS) rather than qualitative and therefore less influenced by observer bias. Data distribution was assumed to be normal, but this was not formally tested. Data distribution is shown as individual data points.
Illustrations
Fig. 1a was generated by Science Shaped (https://scienceshaped.com/). All mouse illustrations were generated using Adobe Illustrator 2022 version 26.0.3.
Reporting summary
Further information on research design is available in the Nature Portfolio Reporting Summary linked to this article.
Data availability
The data that support the findings of this study are included in the text and in the Supplementary Information. Additional datasets used in the study are: the UniProt Homo sapiens database, using Mascot version 2.2.07 (https://www.matrixscience.com), curated human proteome databases UniProtKB/Swiss-Prot and the Protein Data Bank using the ScanProsite tool (https://prosite.expasy.org/scanprosite/), the pMHC class I binding prediction algorithm NetMHC version 4.0 (http://www.cbs.dtu.dk/services/NetMHC/), data from Papaemmanuil et al.15 (https://www.cbioportal.org) and data from Morita et al.45. Exome sequencing data have been deposited at the European Genome–Phenome Archive, which is hosted by the EBI and the CRG, under accession number EGAS00001007467 and can be shared according to institutional guidelines at Oslo University Hospital upon reasonable request. Mass spectrometry data have been deposited at the Proteomics Identification Database under accession number PXD043908. All other data supporting the findings of this study are available from the corresponding author on reasonable request. Source data are provided with this paper.
References
Coulie, P. G. et al. A mutated intron sequence codes for an antigenic peptide recognized by cytolytic T lymphocytes on a human melanoma. Proc. Natl Acad. Sci. USA 92, 7976–7980 (1995).
Wolfel, T. et al. A p16INK4a-insensitive CDK4 mutant targeted by cytolytic T lymphocytes in a human melanoma. Science 269, 1281–1284 (1995).
Matsushita, H. et al. Cancer exome analysis reveals a T-cell-dependent mechanism of cancer immunoediting. Nature 482, 400–404 (2012).
Castle, J. C. et al. Exploiting the mutanome for tumor vaccination. Cancer Res. 72, 1081–1091 (2012).
van Rooij, N. et al. Tumor exome analysis reveals neoantigen-specific T-cell reactivity in an ipilimumab-responsive melanoma. J. Clin. Oncol. 31, e439–e442 (2013).
Rizvi, N. A. et al. Cancer immunology. Mutational landscape determines sensitivity to PD-1 blockade in non-small cell lung cancer. Science 348, 124–128 (2015).
Yarchoan, M., Hopkins, A. & Jaffee, E. M. Tumor mutational burden and response rate to PD-1 inhibition. N. Engl. J. Med. 377, 2500–2501 (2017).
Tran, E. et al. Cancer immunotherapy based on mutation-specific CD4+ T cells in a patient with epithelial cancer. Science 344, 641–645 (2014).
Tran, E. et al. T-cell transfer therapy targeting mutant KRAS in cancer. N. Engl. J. Med. 375, 2255–2262 (2016).
Zacharakis, N. et al. Immune recognition of somatic mutations leading to complete durable regression in metastatic breast cancer. Nat. Med. 24, 724–730 (2018).
Karpanen, T. & Olweus, J. The potential of donor T-cell repertoires in neoantigen-targeted cancer immunotherapy. Front. Immunol. 8, 1718 (2017).
Foy, S. P. et al. Non-viral precision T cell receptor replacement for personalized cell therapy. Nature 615, 687–696 (2023).
Leidner, R. et al. Neoantigen T-cell receptor gene therapy in pancreatic cancer. N. Engl. J. Med. 386, 2112–2119 (2022).
Kim, S. P. et al. Adoptive cellular therapy with autologous tumor-infiltrating lymphocytes and T-cell receptor-engineered T cells targeting common p53 neoantigens in human solid tumors. Cancer Immunol. Res. 10, 932–946 (2022).
Papaemmanuil, E. et al. Genomic classification and prognosis in acute myeloid leukemia. N. Engl. J. Med. 374, 2209–2221 (2016).
Socie, G. & Blazar, B. R. Acute graft-versus-host disease: from the bench to the bedside. Blood 114, 4327–4336 (2009).
Mardiana, S. & Gill, S. CAR T cells for acute myeloid leukemia: state of the art and future directions. Front. Oncol. 10, 697 (2020).
Daver, N., Alotaibi, A. S., Bucklein, V. & Subklewe, M. T-cell-based immunotherapy of acute myeloid leukemia: current concepts and future developments. Leukemia 35, 1843–1863 (2021).
Kenderian, S. S. et al. CD33-specific chimeric antigen receptor T cells exhibit potent preclinical activity against human acute myeloid leukemia. Leukemia 29, 1637–1647 (2015).
Gill, S. et al. Preclinical targeting of human acute myeloid leukemia and myeloablation using chimeric antigen receptor-modified T cells. Blood 123, 2343–2354 (2014).
Jetani, H. et al. CAR T-cells targeting FLT3 have potent activity against FLT3−ITD+ AML and act synergistically with the FLT3-inhibitor crenolanib. Leukemia 32, 1168–1179 (2018).
Olweus, J. et al. Dendritic cell ontogeny: a human dendritic cell lineage of myeloid origin. Proc. Natl Acad. Sci. USA 94, 12551–12556 (1997).
Kim, M. Y. et al. Genetic inactivation of CD33 in hematopoietic stem cells to enable CAR T cell immunotherapy for acute myeloid leukemia. Cell 173, 1439–1453 (2018).
Haubner, S. et al. Coexpression profile of leukemic stem cell markers for combinatorial targeted therapy in AML. Leukemia 33, 64–74 (2019).
Tambaro, F. P. et al. Autologous CD33-CAR-T cells for treatment of relapsed/refractory acute myelogenous leukemia. Leukemia 35, 3282–3286 (2021).
Laszlo, G. S., Estey, E. H. & Walter, R. B. The past and future of CD33 as therapeutic target in acute myeloid leukemia. Blood Rev. 28, 143–153 (2014).
Ali, M. et al. T cells targeted to TdT kill leukemic lymphoblasts while sparing normal lymphocytes. Nat. Biotechnol. 40, 488–498 (2021).
Chapuis, A. G. et al. T cell receptor gene therapy targeting WT1 prevents acute myeloid leukemia relapse post-transplant. Nat. Med. 25, 1064–1072 (2019).
van der Lee, D. I. et al. Mutated nucleophosmin 1 as immunotherapy target in acute myeloid leukemia. J. Clin. Invest. 129, 774–785 (2019).
**e, G. et al. CAR-T cells targeting a nucleophosmin neoepitope exhibit potent specific activity in mouse models of acute myeloid leukaemia. Nat. Biomed. Eng. 5, 399–413 (2021).
Biernacki, M. A. et al. CBFB–MYH11 fusion neoantigen enables T cell recognition and killing of acute myeloid leukemia. J. Clin. Invest. 130, 5127–5141 (2020).
Daver, N., Schlenk, R. F., Russell, N. H. & Levis, M. J. Targeting FLT3 mutations in AML: review of current knowledge and evidence. Leukemia 33, 299–312 (2019).
Daver, N. et al. Secondary mutations as mediators of resistance to targeted therapy in leukemia. Blood 125, 3236–3245 (2015).
Stone, R. M. et al. Midostaurin plus chemotherapy for acute myeloid leukemia with a FLT3 mutation. N. Engl. J. Med. 377, 454–464 (2017).
Smith, C. C. et al. Validation of ITD mutations in FLT3 as a therapeutic target in human acute myeloid leukaemia. Nature 485, 260–263 (2012).
Smith, C. C., Lin, K., Stecula, A., Sali, A. & Shah, N. P. FLT3 D835 mutations confer differential resistance to type II FLT3 inhibitors. Leukemia 29, 2390–2392 (2015).
Smith, C. C. et al. Heterogeneous resistance to quizartinib in acute myeloid leukemia revealed by single-cell analysis. Blood 130, 48–58 (2017).
Stronen, E. et al. Targeting of cancer neoantigens with donor-derived T cell receptor repertoires. Science 352, 1337–1341 (2016).
Ali, M. et al. Induction of neoantigen-reactive T cells from healthy donors. Nat. Protoc. 14, 1926–1943 (2019).
Cohen, C. J., Zhao, Y., Zheng, Z., Rosenberg, S. A. & Morgan, R. A. Enhanced antitumor activity of murine–human hybrid T-cell receptor (TCR) in human lymphocytes is associated with improved pairing and TCR/CD3 stability. Cancer Res. 66, 8878–8886 (2006).
Robbins, P. F. et al. Tumor regression in patients with metastatic synovial cell sarcoma and melanoma using genetically engineered lymphocytes reactive with NY-ESO-1. J. Clin. Oncol. 29, 917–924 (2011).
Bethune, M. T. et al. Isolation and characterization of NY-ESO-1-specific T cell receptors restricted on various MHC molecules. Proc. Natl Acad. Sci. USA 115, E10702–E10711 (2018).
Marcu, A. et al. HLA Ligand Atlas: a benign reference of HLA-presented peptides to improve T-cell-based cancer immunotherapy. J. Immunother. Cancer 9, e002071 (2021).
Jaiswal, S. & Ebert, B. L. Clonal hematopoiesis in human aging and disease. Science 366, eaan4673 (2019).
Morita, K. et al. Clonal evolution of acute myeloid leukemia revealed by high-throughput single-cell genomics. Nat. Commun. 11, 5327 (2020).
Shlush, L. I. et al. Identification of pre-leukaemic haematopoietic stem cells in acute leukaemia. Nature 506, 328–333 (2014).
Goardon, N. et al. Coexistence of LMPP-like and GMP-like leukemia stem cells in acute myeloid leukemia. Cancer Cell 19, 138–152 (2011).
Lapidot, T. et al. A cell initiating human acute myeloid leukaemia after transplantation into SCID mice. Nature 367, 645–648 (1994).
Bonnet, D. & Dick, J. E. Human acute myeloid leukemia is organized as a hierarchy that originates from a primitive hematopoietic cell. Nat. Med. 3, 730–737 (1997).
Schuurhuis, G. J. et al. Minimal/measurable residual disease in AML: a consensus document from the European LeukemiaNet MRD Working Party. Blood 131, 1275–1291 (2018).
Pearlman, A. H. et al. Targeting public neoantigens for cancer immunotherapy. Nat. Cancer 2, 487–497 (2021).
Bassani-Sternberg, M. & Coukos, G. Mass spectrometry-based antigen discovery for cancer immunotherapy. Curr. Opin. Immunol. 41, 9–17 (2016).
Loffler, M. W. et al. Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma. Genome Med. 11, 28 (2019).
Sykulev, Y., Joo, M., Vturina, I., Tsomides, T. J. & Eisen, H. N. Evidence that a single peptide–MHC complex on a target cell can elicit a cytolytic T cell response. Immunity 4, 565–571 (1996).
Scheper, W. et al. Low and variable tumor reactivity of the intratumoral TCR repertoire in human cancers. Nat. Med. 25, 89–94 (2019).
Lowery, F. J. et al. Molecular signatures of antitumor neoantigen-reactive T cells from metastatic human cancers. Science 375, 877–884 (2022).
Nagarsheth, N. B. et al. TCR-engineered T cells targeting E7 for patients with metastatic HPV-associated epithelial cancers. Nat. Med. 27, 419–425 (2021).
Sahin, U. et al. Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer. Nature 547, 222–226 (2017).
Ott, P. A. et al. An immunogenic personal neoantigen vaccine for patients with melanoma. Nature 547, 217–221 (2017).
Lang, F., Schrors, B., Lower, M., Tureci, O. & Sahin, U. Identification of neoantigens for individualized therapeutic cancer vaccines. Nat. Rev. Drug Discov. 21, 261–282 (2022).
Johnson, L. A. et al. Gene therapy with human and mouse T-cell receptors mediates cancer regression and targets normal tissues expressing cognate antigen. Blood 114, 535–546 (2009).
**, B. Y. et al. Engineered T cells targeting E7 mediate regression of human papillomavirus cancers in a murine model. JCI Insight 3, e99488 (2018).
Duan, F. et al. Genomic and bioinformatic profiling of mutational neoepitopes reveals new rules to predict anticancer immunogenicity. J. Exp. Med. 211, 2231–2248 (2014).
Chandran, S. S. et al. Immunogenicity and therapeutic targeting of a public neoantigen derived from mutated PIK3CA. Nat. Med. 28, 946–957 (2022).
Foldvari Z, Knetter C, Yang W, et al. A systematic safety pipeline for selection of T-cell receptors to enter clinical use. NPJ Vaccines https://doi.org/10.1038/s41541-023-00713-y (2023).
Jan, M. et al. Clonal evolution of preleukemic hematopoietic stem cells precedes human acute myeloid leukemia. Sci. Transl. Med. 4, 149ra18 (2012).
Mansilla-Soto, J. et al. HLA-independent T cell receptors for targeting tumors with low antigen density. Nat. Med. 28, 345–352 (2022).
Dolgin, E. First soluble TCR therapy opens ‘new universe’ of cancer targets. Nat. Biotechnol. 40, 441–444 (2022).
Abrahamsen, I. W. et al. Targeting B cell leukemia with highly specific allogeneic T cells with a public recognition motif. Leukemia 24, 1901–1909 (2010).
Kumari, S. et al. Alloreactive cytotoxic T cells provide means to decipher the immunopeptidome and reveal a plethora of tumor-associated self-epitopes. Proc. Natl Acad. Sci. USA 111, 403–408 (2014).
Toebes, M. et al. Design and use of conditional MHC class I ligands. Nat. Med. 12, 246–251 (2006).
Hadrup, S. R. et al. Parallel detection of antigen-specific T-cell responses by multidimensional encoding of MHC multimers. Nat. Methods 6, 520–526 (2009).
Linnemann, C. et al. High-throughput identification of antigen-specific TCRs by TCR gene capture. Nat. Med. 19, 1534–1541 (2013).
Brochet, X., Lefranc, M. P. & Giudicelli, V. IMGT/V-QUEST: the highly customized and integrated system for IG and TR standardized V-J and V-D-J sequence analysis. Nucleic Acids Res. 36, W503–W508 (2008).
Toebes, M., Rodenko, B., Ovaa, H. & Schumacher, T. N. Generation of peptide MHC class I monomers and multimers through ligand exchange. Curr. Protoc. Immunol. 87, 18.16.1–18.16.20 (2009).
Sikorski, K. et al. A high-throughput pipeline for validation of antibodies. Nat. Methods 15, 909–912 (2018).
Carrelha, J. et al. Hierarchically related lineage-restricted fates of multipotent haematopoietic stem cells. Nature 554, 106–111 (2018).
Woll, P. S. et al. Myelodysplastic syndromes are propagated by rare and distinct human cancer stem cells in vivo. Cancer Cell 25, 794–808 (2014).
Gregory, T. et al. Characterization and mitigation of fragmentation enzyme-induced dual stranded artifacts. NAR Genom. Bioinform. 2, lqaa070 (2020).
Shiraishi, Y. et al. An empirical Bayesian framework for somatic mutation detection from cancer genome sequencing data. Nucleic Acids Res. 41, e89 (2013).
Wang, K., Li, M. & Hakonarson, H. ANNOVAR: functional annotation of genetic variants from high-throughput sequencing data. Nucleic Acids Res. 38, e164 (2010).
Yoshizato, T. et al. Genetic abnormalities in myelodysplasia and secondary acute myeloid leukemia: impact on outcome of stem cell transplantation. Blood 129, 2347–2358 (2017).
Rampal, R. & Figueroa, M. E. Wilms tumor 1 mutations in the pathogenesis of acute myeloid leukemia. Haematologica 101, 672–679 (2016).
Jain, N. et al. TET2 guards against unchecked BATF3-induced CAR T cell expansion. Nature 615, 315–322 (2023).
Jurtz, V. et al. NetMHCpan-4.0: improved peptide–MHC class I interaction predictions integrating eluted ligand and peptide binding affinity data. J. Immunol. 199, 3360–3368 (2017).
Wang, M. et al. Validation of risk stratification models in acute myeloid leukemia using sequencing-based molecular profiling. Leukemia 31, 2029–2036 (2017).
Acknowledgements
We thank the Oslo University Hospital (OUH) flow cytometry core facility for excellent technical assistance. This work was supported by the Research Council of Norway through its Centres of Excellence scheme (332727) and through grant 316060, the Norwegian Cancer Society grant 216135-2020, South-Eastern Regional Health Authority Norway (2021074), the Norwegian Childhood Cancer Foundation, Stiftelsen Kristian Gerhard Jebsen, the European Research Council under the European Union’s Horizon 2020 research and innovation program (grant agreement no. 865805), the University of Oslo and Oslo University Hospital and the Novo Nordisk Foundation (to J.O.), by the Knut and Alice Wallenberg Foundation (KAW 2016.0105 to S.E.W.J. and KAW 2015.0195 to P.S.W.), the Swedish Research Council (538-2013-8995 to S.E.W.J. and 2015-03561 to P.S.W.) and by funding to S.E.W.J.: the Tobias Foundation (4-1122/2014), the Torsten Söderberg Foundation, the Center for Innovative Medicine at Karolinska Institutet (613/06) and the UK Medical Research Council (MC_UU_12009/5).
Author information
Authors and Affiliations
Contributions
E.G.: conceptualization, methodology, acquisition, analysis and interpretation of data, investigation, writing (original draft), writing (review and editing). M. Lehander and S.V.C.: methodology, acquisition, analysis and data interpretation, writing (original draft), writing (review and editing). W.Y., Y.L., T.K., M.M.N., R.C.B., T.T.T., T.Y., E.H.R., K.D., M. Laos, J.S.H., A.K.B., S.M., D.W.L.C.: acquisition, analysis and data interpretation. T.J.G., M.D.-S., A.H.: project administration, resources. M.A., A.M.: methodology. M.B., M.G., T.G.-D., S.L.: resources. S.E.W.J.: conceptualization, methodology, analysis and interpretation of data, investigation, supervision, funding acquisition, writing (original draft), writing (review and editing). P.S.W.: conceptualization, methodology, acquisition, analysis and interpretation of data, investigation, supervision, resources, writing (original draft), writing (review and editing). J.O.: conceptualization, methodology, supervision, analysis and interpretation of data, investigation, funding acquisition, writing (original draft), writing (review and editing).
Corresponding authors
Ethics declarations
Competing interests
A patent application has been filed by the Oslo University Hospital institutional technology transfer office Inven2 protecting the TCR sequence (J.O. and E.G. are inventors). J.O. is on the scientific advisory board of Asgard Therapeutics and is a cofounder of T-Rx therapeutics, a company that aims to develop TCR T cell therapies. The other co-authors declare no competing interests.
Peer review
Peer review information
Nature Cancer thanks Saar Gill, Alexandre Harari and Claude Perreault for their contribution to the peer review of this work.
Additional information
Publisher’s note Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Extended data
Extended Data Fig. 1 T cells reactive to FLT3D/Y HLA-A2 can be induced by culture of naïve healthy donor T cells but are not identified among memory T cells from AML patients in diagnostic samples or following HSCT.
(a) Predicted binding affinity of FLT3D/Y and FLT3WT peptides using the NetMHC-4.0 algorithm. Peptides with affinity <50 nM (EL%Rank <0.500) classify as strong binders, 50 nM<affinity<500 nM (EL%Rank <2.000) as weak binders and affinity >500 nM as non- binders85. (b) Gating strategy to identify CD8+ T cells staining as double positive events for pMHC multimers (APC- and PE-conjugated) complexed with the FLT3D/Y peptide. The three left plots show gates used for FSC/SSC, singlets and Live/Dead Fixable Near- IRneg/CD8+ events. The plot to the right shows multimer positive events in co-culture of naïve healthy donor CD8+ T cells with autologous moDCs transfected with target mRNA. (c) The TCRFLT3D/Y sequence. (d) Staining of samples from AML patients taken at point of diagnosis (top row, left three panels) and post allo-HSCT (bottom row) with pMHC multimers. TCRFLT3D/Y transduced T cells were used as a positive control for multimer staining (top right). (e) Staining of samples obtained from patient 2 after allo-HSCT following 5 days of in vitro expansion in absence (left) and presence (right) of the FLT3D/Y peptide (top panels). As positive control for in vitro expansion of memory T cells, TCRFLT3D/Y T cells were spiked into autologous healthy PBMCs under the same conditions (bottom panels). Inset numbers represent the percentage of pMHC multimer+ cells out of CD8+ cells. The graph to the right shows data for all three patients and positive controls. Data shown are from one experiment with each dot representing a technical replicate (n = 7 for pt 1, n = 12 for pt 2, n = 8 for pt 12 and n = 3 for PBMC healthy donor).
Extended Data Fig. 2 Tandem mass spectra of endogenous vs isotopically labelled peptide.
Mirror image plots comparing the fragmentation spectra of endogenous FLT3D/Y peptide to its isotopically labelled counterpart YI(13C6,15 N)MSDSNYV. Spectra obtained from immunoprecipitated HLA derived from the B721.221 cell line retrovirally transduced with a minigene encoding the D835Y mutation, and from patient 1 and patient 3, are displayed.
Extended Data Fig. 3 TCRFLT3D/Y cells maintain a predominantly naïve phenotype following expansion.
(a) Staining of TCRFLT3D/Y cells with pMHC multimers complexed with either the FLT3D/Y or the FLT3WT peptide (each multimer conjugated to both APC and PE, gating strategy shown in Extended Data Fig. 1b. Data shown is from one representative donor out of two stained in one experiment. (b) Gating strategy for TCRFLT3D/Y cells. Panels show gating on: CD8+ cells labeled with the APC pMHC multimer and antibodies reactive to mouse TCR-β or human TCR-α (middle panels), and CD8+ cells staining positively for APC and PE-labeled pMHC multimers complexed with the FLT3D/Y peptide (right plot). (c) Percentage of mTCR-β+ cells or pMHC multimer+ cells among CD8+ cells following transduction with the TCRFLT3D/Y. Each data point represents a different HLA-A2pos donor (n = 7 donors from 3 independent experiments). Data are analyzed by unpaired, two-tailed Student’s t-test and p < 0.05 was considered statistically significant. (d) Gating strategy to identify differentiation stages of TCR-transduced T cells three days after spinoculation. Top panels show gating on FSC/SSChi, Live/Dead Fixable Near-IRneg, CD3+ events. Bottom panels show gating on CD4+ or CD8+ populations and subsequent identification of naïve, central memory (CM), effector (E) and effector memory (EM) cells as defined by expression of CD45RA and CD62L analyzed in two donors in one experiment. (e) Expansion of HLA-A2pos PB T cells from two donors transduced in parallel with the TCRFLT3D/Y or TCR1G4 following indicated days after retroviral transduction. Data are from one experiment and dots represent one technical replicate for each HLA-A2pos PB T cell donor. (f) Activation of TCR1G4 cells measured as upregulation of CD137 after co-incubation with peptide-pulsed (NY-ESO-1 peptide SLLMWITQC) BV173 cells (K562 cells were not used, in contrast to Fig. 1f, as they express NY-ESO-1). EC50 = half maximal effective concentration (linear curve fitting). Data shown are from one experiment with one (out of two) T cell donors with individual data points representing technical replicates (n = 3).
Extended Data Fig. 4 Map** of peptide specificity does not reveal unintended targets to which the TCRFLT3D/Y cells cross-react.
(a) Graphs depicting IFN-γ response of TCRFLT3D/Y cells to K562 cells loaded with individual peptides from mimotope library containing a total of 161 nine-mers for the FLT3D/Y peptide, at a concentration of 10−8 M. Purple dots in each graph represent response to the FLT3D/Y peptide. Substituted amino acid in the original peptide is highlighted. IFN-γ concentration range for positive reactions was 5000–35000 pg/mL (cut-off indicated by horizontal lines). Graphs show results from two independent experiments that were performed, one technical replicate (dot) per peptide and experiment. (b) Peptide reactivity motifs for FLT3D/Y that were queried in the ScanProsite search tool against human proteome databases. Amino acids in square brackets [] indicate alternatives that are allowed for the given position in the peptide motifs. (c) mRNA-encoded amino acid sequences(30-32mers) derived from the sequence of the human proteins LZTR1, MED1 and PRADC1, with the candidate cross-reactive peptide identified in the ScanProsite database underlined. (d) Expression of mRNA encoding LZTR1, MED1 and PRADC1 sequences following electroporation of HLA-A2pos K562 cells as measured by GFP-reporter fluorescence using flow cytometry.
Extended Data Fig. 5 Re-analysis of published mutation data for 58 FLT3 D835Y positive AML patient samples shows high VAF for FLT3 D835Y in a large fraction of patients.
(a) Mutation data (SNVs and indels) from AML patients reported in Papaemmanuil et al, 2016 NEJM were downloaded from https://www.cbioportal.org/. VAF was estimated from reported alternative allele reads divided by sequencing depth for the position. Patients harboring a FLT3 D835Y mutation were selected for in-depth analysis and displayed here. Patients are sorted from right to left within each subsection in descending order of FLT3 D835Y VAF. The following genes were considered as initiating events in clonal hematopoiesis (CH): DNMT3A, TET2, ASXL1, PPM1D, JAK2, SF3B1, SRSF2, TP53, GNAS and GNB1. (b) Mutation data from FLT3 D835Y positive AML patients (n = 9) reported in Morita et al, 2020 Nat Com were downloaded. The fraction of cells with mutations (mutant cell fraction) in each AML patient with mutations are plotted in indicated colors. Patients were categorized into 3 groups; FLT3 D835Y largest, only preceded by mutations in DNMT3A, TET2, and/or ASXL1 (DTA) and/or splicing factor mutations (SF3B1, SRAF2, and U2AF1) which are closely related with clonal hematopoiesis ‘CH’, and the rest of cases with FLT3 D835Y mutation according to the cell fraction of mutations. Interquartile range (IQR) and median values are shown. The dashed lines indicate 1.5xIQR and the dots indicate outliers.
Extended Data Fig. 6 TCRFLT3D/Y cells are activated by, and efficiently kill, primary AML cells expressing FLT3D/Y.
(a) Flow cytometry plots showing gating strategy to identify cell subsets in AML patient samples from PB (patient 2-6) or BM (patient 1). Cells are gated on FSC/SSChi, single, Live/Dead Fixable Near-IR events (top row), showing the fractions of CD3+ T cells, CD19+CD20+ B cells and myeloid cells, defined as CD3−CD19−CD20− events in the bottom row. (b) Populations were overlaid on a t- SNE plot (patient 1) with designated colors as indicated. Inset numbers show event counts for myeloid cells after co-culture with TCR1G4 or TCRFLT3D/Y cells, quantified as shown in e. (c) Quantification of normal CD19+ B cells isolated from n = 3 healthy blood donors (Buffy coat (BC) 1 - BC 3) and tumor cells from patient 1 (positive control) after performing the flow cytometry-based cytotoxicity assay for 72 h. Data points represent n = 3 technical replicates from one experiment and horizontal lines show mean. (d) Bar graph showing IFN-γ response of Mock (gray) and TCRFLT3D/Y cells (purple) after 24 h co-culture with HLA-A2pos patient cells expressing the FLT3 D835Y (Pt.1-6), FLT3 D835E (Pt.9) or FLT3 D835H (Pt. 10), or Pt.8 cells expressing FLT3 D835Y but being HLA-A2neg. Data points represent n = 3 technical replicates and bars show mean. Data shown are from one experiment representative of at least two performed for each patient sample. (e) Gating strategy for flow cytometry cytotoxicity assay to quantify viable cells in subpopulations from AML patients 1-3 after 72 h of co-culture with autologous T cells either expressing TCRFLT3D/Y (bottom row) or mock-transduced. Transduced T cells were labeled with cell-trace violet (shown in upper right plot) prior to co-culture with AML cells to distinguish them from T cells in the AML samples. Patient cell subsets are gated on FSC/SSC, singlets, Live/Dead Fixable Near-IRneg, CTVneg events. Numbers indicate absolute counts for CD3+, CD19+/CD20+ and myeloid cells after co-culture, as determined by addition of fluorescent beads (10,000) into each well and where 3,500 beads were acquired for flow cytometry analysis (shown in upper left plot).
Extended Data Fig. 7 TCRFLT3D/Y cells efficiently target leukemia in a xenograft mouse model.
(a) Flow cytometry histograms showing expression of FLT3D/Y as measured by GFP- reporter fluorescence in transduced AML and B-ALL cell lines. Negative control (non-transduced BV173 cells) in top histogram. (b) Remaining viable FLT3D/Y-transduced, HLA-A2+ cells (purple dots) after 24 h co-culture with TCRFLT3D/Y cells (E:T ratio of 1:2), in percent of corresponding numbers following treatment with mock-transduced T cells (grey dots), quantified by flow cytometry. +A2 denotes that HLA-A2 was introduced by transduction. Data points are from n = 3 independent experiments with each dot representing the mean of n = 3 technical replicates in each experiment and are shown as mean ± s.e.m. Gating strategy and quantification as shown in Extended Data Fig. 6e. (c) Schematic overview of the BV173D835Y in vivo model. (d) Bioluminescence imaging (BLI) analysis of NSG mice day 13 after BV173D835Y cell injection, one day prior to T-cell therapy. Data shown are from one experiment, with mice grouped into untreated (n = 3 mice), TCR1G4 (n = 3 mice) and TCRFLT3D/Y (n = 4 mice) cell treated. (e) BLI of BV173D835Y engrafted leukemic cells in mice on indicated days relative to treatment with TCR1G4 or TCRFLT3D/Y cells, or no treatment. (f) Quantification of BV173D835Y engrafted leukemic cells in mice, 21 days after treatment with TCR1G4 or TCRFLT3D/Y cells or left untreated. (g) Flow cytometry plots showing BM tumor burden in two untreated and two TCR1G4 cell-treated mice at time of sacrifice (d 21), as well as two TCRFLT3D/Y cell treated mice sacrificed at end of experiment (d 53). (h) Percentage of bone marrow BV173D835Y leukemic cells in mice treated with TCR1G4 or TCRFLT3D/Y cells, or left untreated, out of total mouse and human CD45+ cells (21-53 days after treatment start). (i) Percentage of TCR-β+ cells out of human CD8+ cells in the BM of mice analyzed at point of sacrifice. Data in d, f, h, i are presented as mean ± s.e.m, are from one experiment with each dot representing an individual mouse, and are analyzed by unpaired, two-tailed Student’s t-test. P values are shown and p < 0.05 was considered statistically significant.
Extended Data Fig. 8 TCRFLT3D/Y cells persist in vivo and mediate recovery of mouse hematopoiesis in patient 7 PDX model.
(a) Representative FACS plots of viable single PB MNCs from TCR1G4 (top) and TCRFLT3D/Y (bottom) T cell-treated NSG-SGM3 mice stably engrafted with primary AML FLT3 D835Y cells from patient 7 at 14 days post T cell infusion. Equivalent gating as shown was also used for spleen. (b) Number of total MNCs in BM and spleen of TCR T cell treated mice. (c) Number of mouse MNCs (mCD45+ cells) in spleen. (d) Number of total hCD3+ cells in BM and spleen. (e-f) Percentage of mTCR-β+CD8+ cells of hCD3+ cells (e) and percentage of mTCR-β+ cells of hCD8+ cells (f) in T cell samples used for injection and at indicated days after T cell injection, in PB. (g) Distribution (%) of CD4 and CD8 cells within the human CD3+ T cell samples used for injection, and in PB, BM and spleen 14-15 days after injection into mice. All data are from terminal analysis 15 days post T-cell infusion if not otherwise stated. The data are presented as mean ± s.e.m. of n = 6 individual mice treated with TCR1G4 cells and of n = 7 individual mice treated with TCRFLT3D/Y cells, measured in one experiment. Each dot represents one mouse and statistical analysis was performed with two-tailed Mann-Whitney test. P values are shown and p < 0.05 was considered statistically significant.
Extended Data Fig. 9 TCRFLT3D/Y cells eliminate FLT3D835Y leukemia cells and persist in vivo in patient 1 PDX model.
(a) Percentage of CD33+ cells in BM and PB at endpoint (day 34 post T cell infusion) of TCR1G4 cell (n = 4) or TCRFLT3D/Y cell (n = 4) treated mice. Numbers adjusted for hCD3+ T cells. (b) Number of total MNCs in BM and spleen of TCR T cell treated mice. (c) Representative ddPCR plots of BM from TCR cell-treated mice. Numbers in quadrants represent %VAF (mean ± s.e.m.) of the FLT3D/Y in BM among hCD45+CD33+CD34+, hCD45+CD33+CD34− and hCD45+CD19+ cells from TCRFLT3D/Y cell-treated (left) and TCR1G4 cell-treated (right) mice. ‘No remaining cells’ due to elimination of hCD45+CD33+CD34+ cells in TCRFLT3D/Y cell-treated mice. (d) Number of total hCD3+ cells in BM and spleen. (e-g) Percentage of mTCR-β+CD8+ cells of hCD3+ cells (e) and percentage of mTCR-β+ cells of hCD8+ cells (f) in sample used for injection and at indicated days after T cell infusion in PB. (g) Distribution (%) of CD4 and CD8 cells within the human CD3+ T cell samples analyzed prior to injection, and in PB, BM and spleen of individual mice at endpoint. All data are from terminal analysis 34 days post T-cell infusion unless otherwise stated. The data are presented as mean ± s.e.m. of n = 4 individual mice treated with TCR1G4 cells and of n = 4 mice treated with TCRFLT3D/Y cells, measured in one experiment. Each dot represents one mouse and statistical analysis was performed with two-tailed Mann-Whitney test. P values are shown and p < 0.05 was considered statistically significant.
Extended Data Fig. 10 Lack of in vivo T-cell expansion upon transplantation of primary AML cells co-cultured with TCR1G4 or TCRFLT3D/Y T cells.
Representative FACS profiles of engrafted human CD45+ cells in the PB of mice analyzed at indicated weeks after transplantation of all cells remaining after 48 hours in vitro culture of AML cells without T cells (left), AML cells co-cultured with TCR1G4 cells (middle) or AML cells co-cultured with TCRFLT3D/Y cells (right). Profiles are from one mouse per treatment group from one experiment out of two performed.
Supplementary information
Supplementary Information
Supplementary Tables 1–10. Supplementary Table 1: List of candidate off-target peptides reactive to TCRFLT3D/Y cells.Amino acid sequence of all potentially cross-reactive peptides predicted by the ScanProsite algorithm based on positive reactivities of the TCRFLT3D/Y cells against the peptide mimotope library of 161 peptides, shown in Fig. 1h. Supplementary Table 2: Clinical information for all leukemia patients included in the study.M, male; F, female; AML, acute myeloid leukemia; AMML, acute myelomonocytic leukemia; APL, acute promyelocytic leukemia. Cytogenetic characteristics from clinical diagnostics: TKD, tyrosine kinase domain; CFBbeta-MYH11 fusion inv(16)(p13,q22) is an inversion of chromosome 1–6, which results in a fused transcript between MYH11 (16p13.1) and CBFB (16q22.1); ITD, Internal tandem duplication; del(6q), deletion in long arm of chromosome 6. Allo-HSCT; allogeneic hematopoietic stem cell transplantation. Supplementary Table 3: Sequencing data for all FLT3D/Y positive leukemia patients.PT ID, Patient ID; Chr = chromosome; VAF, Variant allele frequency. Data for patients 16 was acquired using the TruSight™ Myeloid Panel. Data for patient 7 was acquired using the DFCI Rapid Heme Panel v2.0 (JAX Laboratories). Data for patient 8 was acquired by a custom-designed targeted DNA sequencing panel86. Supplementary Table 4: Number of events recorded by flow cytometry in PB, BM and spleen at terminal analysis for PDX models.Total event count is defined as single, viable, MNCs (mCD45+ cells + hCD45+ cells) adjusted for T cells by subtraction of hCD3+ events. Supplementary Table 5: ddPCR analysis of the FLT3 D835Y mutation in BM from micePD–X model with AML patient 7.Mouse ID; Population; Treatment; Number of cells analyzed; %VAF, variant allele frequency; CI, confidence interval; min, minimum %VAF of 95% CI; max, maximum %VAF of 95% CI; %CD33+ cells of hCD45+CD3- cells. Supplementary Table 6: Number of events recorded by flow cytometry in PB, BM and spleen at terminal analysis for PDX models.Total event count is defined as single, viable, MNCs (mCD45+ cells + hCD45+ cells) adjusted for T cells by subtraction of hCD3+ events. Supplementary Table 7: Somatic mutations in AML patient 1 BM blasts identified by whole exome sequencing.Somatic mutations identified by whole exome sequencing of blasts (CD3−CD19−) from BM of patient 1 were also detected in the two analyzed PDX mice transplanted with patient 1 blasts (one TCR1G4 cell treated mouse and one untreated mouse, both mCD45−hCD45+CD3−CD19). The FLT3D/Y mutation and a WT1 mutation (bold) were selected for further ddPCR analysis, shown in Fig. 4d and Extended Data Fig. 9c. Supplementary Table 8: ddPCR analysis of FLT3 D835Y and WT1 H507P mutations in BM from AML patient 1 and in transplanted PDX mice.Sample ID; Abbreviations; VAF, variant allele frequency; CI, confidence interval; min, mimimum VAF of 95% CI; max, maximum VAF of 95% CI. *Not enough cells for quantification. Supplementary Table 9: Number of events recorded by flow cytometry in PB, BM and spleen at terminal analysis for PDX models.Total event count is defined as single, viable, MNCs (mCD45+ cells + hCD45+ cells) adjusted for T cells by subtraction of hCD3+ events. Supplementary Table 10: Complete list of all antibodies used in the study.
Source data
Source Data Fig. 1
Statistical source data for Fig. 1.
Source Data Fig. 2
Statistical source data for Fig. 2.
Source Data Fig. 3
Statistical source data for Fig. 3.
Source Data Fig. 4
Statistical source data for Fig. 4.
Source Data Fig. 5
Statistical source data for Fig. 5.
Source Data Extended Data Fig. 1
Statistical source data for Extended Data Fig. 1.
Source Data Extended Data Fig. 3
Statistical source data for Extended Data Fig. 3.
Source Data Extended Data Fig. 4
Statistical source data for Extended Data Fig. 4.
Source Data Extended Data Fig. 6
Statistical source data for Extended Data Fig. 6.
Source Data Extended Data Fig. 7
Statistical source data for Extended Data Fig. 7.
Source Data Extended Data Fig. 8
Statistical source data for Extended Data Fig. 8.
Source Data Extended Data Fig. 9
Statistical source data for Extended Data Fig. 9.
Rights and permissions
Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
About this article
Cite this article
Giannakopoulou, E., Lehander, M., Virding Culleton, S. et al. A T cell receptor targeting a recurrent driver mutation in FLT3 mediates elimination of primary human acute myeloid leukemia in vivo. Nat Cancer 4, 1474–1490 (2023). https://doi.org/10.1038/s43018-023-00642-8
Received:
Accepted:
Published:
Issue Date:
DOI: https://doi.org/10.1038/s43018-023-00642-8
- Springer Nature America, Inc.
This article is cited by
-
Immunotargeting of a recurrent AML-specific neoantigen
Nature Cancer (2023)